CJC-1295
In Stock
Price range: $40.00 through $60.00
These products are intended for laboratory research purposes only, and are not for human or animal consumption. The products are not intended to diagnose, treat, cure, or prevent any disease. The products should not be used as a food, drug, cosmetic, or other household use.
Description
Certificates of Analysis
Analysis Date:
Lot Number:
Properties | |
|---|---|
| CAS Number | 863288-34-0 |
| Synonyms | CJC-1295 with DAC, CJC-1295 without DAC, Modified GRF 1-29, tetrasubstituted GRF 1-29 |
| Content | 5mg |
| Physical Appearance | Fine White Lyophilized Powder |
| Sequence | YADAIFTQSYRKVLAQLSARKLLQDILSRK |
| Molecular Formula | C152H252N44O42 |
| Molecular Weight | ~3368 g/mol |
| Pubchem LCSS | |
| Terms | Laboratory research use only (RUO). Not for human, animal, diagnostic, or household use. |
2D Structure
