CJC-1295

In Stock

Price range: $40.00 through $65.00

Quantity Discounts

QuantityPrice
3 +$38.00 - $61.75
These products are intended for laboratory research purposes only, and are not for human or animal consumption. The products are not intended to diagnose, treat, cure, or prevent any disease. The products should not be used as a food, drug, cosmetic, or other household use.

Description

Certificates of Analysis

Analysis Date:
Lot Number:

June 16, 2026

CJD002

Full report View Historical

Properties

CAS Number

863288-34-0

Synonyms

CJC-1295 with DAC, CJC-1295 without DAC, Modified GRF 1-29, tetrasubstituted GRF 1-29

Content

5mg

Physical Appearance

Fine White Lyophilized Powder

Sequence

YADAIFTQSYRKVLAQLSARKLLQDILSRK

Molecular Formula

C152H252N44O42

Molecular Weight

~3368 g/mol

Pubchem LCSS

CJC-1295 Laboratory Chemical Safety Summary

Terms

Laboratory research use only (RUO). Not for human, animal, diagnostic, or household use.

2D Structure

2D Structure

Related Products

Specialized peptides advancing the edge of scientific research.

Shipping & Support Hours:
Monday - Friday 9AM - 5PM PST

Arcane Newsletter

Disclaimer: These products are intended for laboratory research purposes only, and are not for human or animal consumption. The products are not intended to diagnose, treat, cure, or prevent any disease. The products should not be used as a food, drug, cosmetic, or other household use. By accessing this website or purchasing from this website, you agree that that it is your sole responsibility to ensure compliance with applicable laws and regulations within your jurisdiction; and you understand and acknowledge that no information on this website should be construed as medical advice. You also acknowledge and agree that you have read the Terms of Service available on this website and agree that your rights and responsibilities are governed by the Terms of Service on this website. Arcane Peptides is a chemical supplier and is not a compounding pharmacy or chemical compounding facility as defined under Section 503A of the Federal Food, Drug, and Cosmetic Act. Additionally, Arcane Peptides is not an outsourcing facility as defined under Section 503B of the same Act.
© 2026 Arcane Peptides All rights reserved.

Shopping Cart0

No products in the cart.