-60%
Teriparatide 10MG
In Stock
Original price was: $60.00.$24.00Current price is: $24.00.
81 in stock
These products are intended for laboratory research purposes only, and are not for human or animal consumption. The products are not intended to diagnose, treat, cure, or prevent any disease. The products should not be used as a food, drug, cosmetic, or other household use.
Description
Certificates of Analysis
Analysis Date:
Lot Number:
Properties | |
|---|---|
| CAS Number | 52232-67-4 |
| Synonyms | Teriparatidum |
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Molecular Formula | C181H291N55O51S2 |
| Molecular Weight | 4118 g/mol |
| Content | 10mg |
| Physical Appearance | Fine White Lyophilized Powder |
| Pubchem LCSS | |
| Terms | Laboratory research use only (RUO). Not for human, animal, diagnostic, or household use. |
2D Structure
Related Products
-
Price range: $35.00 through $50.00
